Amyloid β-Protein (1-40)

Description:

Aβ 1-40 and Aβ 1-42 have been used to detect amyloid β-protein multimers in the cerebrospinal fluid of Alzheimer's disease patients. Aβ 1-40 shows both neurotrophic and neurotoxic effects in dependence on the neuronal age and the concentration of the β-protein

Sequence:

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

General

References

Comments (0)

Name	Amyloid β-Protein (1-40)
Category	Beta-Amyloidand Related Peptides
One Letter Code	DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Three Letter Code	{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}{Gly}{Gly}{Val}{Val}
Molecular Weight	4329.860
Application	Alzheimer's Disease

Espargaró Colomé, Alba, et al. "Ultra rapid in vivo screening for anti-Alzheimer anti-amyloid drugs." Scientific Reports, 2016, vol. 6, p. 23349 (2016).

Zhang-Haagen, Bo, et al. "Monomeric amyloid beta peptide in hexafluoroisopropanol detected by small angle neutron scattering." PLoS One 11.2 (2016).

Zhang, Ji, Yi-rong Ding, and Rui Wang. "Inhibition of tissue transglutaminase promotes Aβ-induced apoptosis in SH-SY5Y cells." Acta Pharmacologica Sinica 37.12 (2016): 1534-1542.

Rubagotti, Sara, et al. "Affinity of nat/68Ga-labelled curcumin and curcuminoid complexes for β-amyloid plaques: towards the development of new metal-curcumin based radiotracers." International journal of molecular sciences 17.9 (2016): 1480.

Zha, Xiaoming, et al. "Novel tacrine–benzofuran hybrids as potent multitarget-directed ligands for the treatment of Alzheimer’s disease: design, synthesis, biological evaluation, and X-ray crystallography." Journal of medicinal chemistry 59.1 (2016): 114-131.