Beta - Amyloid (1 - 39)
| Name | Beta - Amyloid (1 - 39) |
| Category | Beta-Amyloidand Related Peptides |
| One Letter Code | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV |
| Three Letter Code | {Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}{Gly}{Gly}{Val} |
| Molecular Weight | 4230.700 |
| Application | Alzheimer's Disease |
| Giacomelli, Carla E., and Willem Norde. "Conformational Changes of the Amyloid β‐Peptide (1–40) Adsorbed on Solid Surfaces." Macromolecular bioscience 5.5 (2005): 401-407. |
| Moore, Brenda D., et al. "Overlapping profiles of Aβ peptides in the Alzheimer's disease and pathological aging brains." Alzheimer's research & therapy 4.3 (2012): 18. |
| Schieb, Heinke, et al. "β-Amyloid Peptide Variants in Brains and Cerebrospinal Fluid from Amyloid Precursor Protein (APP) Transgenic Mice COMPARISON WITH HUMAN ALZHEIMER AMYLOID." Journal of Biological Chemistry 286.39 (2011): 33747-33758. |
| Bibl, Mirko, et al. "CSF amyloid-β-peptides in Alzheimer's disease, dementia with Lewy bodies and Parkinson's disease dementia." Brain 129.5 (2006): 1177-1187. |
| Wiltfang, Jens, et al. "Highly conserved and disease‐specific patterns of carboxyterminally truncated Aβ peptides 1–37/38/39 in addition to 1–40/42 in Alzheimer's disease and in patients with chronic neuroinflammation." Journal of neurochemistry 81.3 (2002): 481-496. |