Beta - Amyloid (1 - 39)

Description:

Aβ protein variant.Small quantities of Aβ37, 38 and 39 can be detected in CSF together with Aβ40, the most abundant Aβ homolog, Aβ42, and N-terminally truncated amyloid peptides.

Sequence:

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
  • General
  • References
  • Comments (0)
  • Name Beta - Amyloid (1 - 39)
    Category Beta-Amyloidand Related Peptides
    One Letter Code DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
    Three Letter Code {Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}{Gly}{Gly}{Val}
    Molecular Weight 4230.700
    Application Alzheimer's Disease
    Giacomelli, Carla E., and Willem Norde. "Conformational Changes of the Amyloid β‐Peptide (1–40) Adsorbed on Solid Surfaces." Macromolecular bioscience 5.5 (2005): 401-407.
    Moore, Brenda D., et al. "Overlapping profiles of Aβ peptides in the Alzheimer's disease and pathological aging brains." Alzheimer's research & therapy 4.3 (2012): 18.
    Schieb, Heinke, et al. "β-Amyloid Peptide Variants in Brains and Cerebrospinal Fluid from Amyloid Precursor Protein (APP) Transgenic Mice COMPARISON WITH HUMAN ALZHEIMER AMYLOID." Journal of Biological Chemistry 286.39 (2011): 33747-33758.
    Bibl, Mirko, et al. "CSF amyloid-β-peptides in Alzheimer's disease, dementia with Lewy bodies and Parkinson's disease dementia." Brain 129.5 (2006): 1177-1187.
    Wiltfang, Jens, et al. "Highly conserved and disease‐specific patterns of carboxyterminally truncated Aβ peptides 1–37/38/39 in addition to 1–40/42 in Alzheimer's disease and in patients with chronic neuroinflammation." Journal of neurochemistry 81.3 (2002): 481-496.
    #[first_name]
    #[create_date]
    #[comment]
    Reply(#[reply_num])
    #[like_num]
  • #[first_name]
    #[create_date]
    #[comment]
    Reply
    #[like_num]