Beta - Amyloid (1 - 38)

Description:

The Aβ 1-38 destabilizes calcium homeostasis and renders human cortical neurones vulnerable to environmental insults.

Sequence:

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG

General

References

Comments (0)

Name	Beta - Amyloid (1 - 38)
Category	Beta-Amyloidand Related Peptides
One Letter Code	DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
Three Letter Code	{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}{Gly}{Gly}
Molecular Weight	4131.600
Application	Alzheimer's Disease

Hanenberg, Michael, et al. "Amyloid-β peptide-specific DARPins as a novel class of potential therapeutics for Alzheimer disease." Journal of Biological Chemistry 289.39 (2014): 27080-27089.

Wagner, Steven L., et al. "Soluble γ-secretase modulators selectively inhibit the production of the 42-amino acid amyloid β peptide variant and augment the production of multiple carboxy-truncated amyloid β species." Biochemistry 53.4 (2014): 702-713.

Mengel, D., et al. "Naturally occurring autoantibodies interfere with β-amyloid metabolism and improve cognition in a transgenic mouse model of Alzheimer’s disease 24 h after single treatment." Translational psychiatry 3.3 (2013): e236-e236.

Bibl, Mirko, et al. "Stability of amyloid‐β peptides in plasma and serum." Electrophoresis 33.3 (2012): 445-450.

Schieb, Heinke, et al. "A method to prevent cross contamination during 2‐DE by β‐amyloid peptides." Proteomics 10.19 (2010): 3539-3543.

Hieke, Martina, et al. "Design, synthesis, and biological evaluation of a novel class of γ-secretase modulators with PPARγ activity." Journal of medicinal chemistry 53.12 (2010): 4691-4700.

Reinert, Jochim, et al. "Aβ 38 in the brains of patients with sporadic and familial Alzheimer's disease and transgenic mouse models." Journal of Alzheimer's Disease 39.4 (2014): 871-881.