(Met(O)³⁵)-Amyloid β-Protein (1-40)
| Name | (Met(O)³⁵)-Amyloid β-Protein (1-40) |
| Category | Beta-Amyloidand Related Peptides |
| One Letter Code | DAEFRHDSGYEVHHQKLVFFAEDVGFAMSNKGAIIGLM(O)VGGVV |
| Three Letter Code | {Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met(O)}{Val}{Gly}{Gly}{Val}{Val} |
| Molecular Weight | 4345.860 |
| Application | Alzheimer's Disease |
| Brown, Anne M., et al. "Simulations of monomeric amyloid β-peptide (1–40) with varying solution conditions and oxidation state of Met35: implications for aggregation." Archives of biochemistry and biophysics 545 (2014): 44-52. |
| Johansson, Ann-Sofi, et al. "Attenuated amyloid-β aggregation and neurotoxicity owing to methionine oxidation." Neuroreport 18.6 (2007): 559-563. |
| Hou, Liming, et al. "Solution NMR studies of the Aβ (1− 40) and Aβ (1− 42) peptides establish that the Met35 oxidation state affects the mechanism of amyloid formation." Journal of the American Chemical Society 126.7 (2004): 1992-2005. |
| Palmblad, Magnus, Anita Westlind-Danielsson, and Jonas Bergquist. "Oxidation of methionine 35 attenuates formation of amyloid β-peptide 1–40 oligomers." Journal of Biological Chemistry 277.22 (2002): 19506-19510. |