[Cys26] - beta - Amyloid (1 - 40), S26C beta - Amyloid (1 - 40)
| Name | [Cys26] - beta - Amyloid (1 - 40), S26C beta - Amyloid (1 - 40) |
| Category | Beta-Amyloidand Related Peptides |
| One Letter Code | DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVV |
| Three Letter Code | {Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asp}{Val}{Gly}{Cys}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}{Gly}{Gly}{Val}{Val} |
| Molecular Weight | 4345.900 |
| Application | Alzheimer's Disease |
| Jin, Ming, et al. "Soluble amyloid β-protein dimers isolated from Alzheimer cortex directly induce Tau hyperphosphorylation and neuritic degeneration." Proceedings of the National Academy of Sciences 108.14 (2011): 5819-5824. |
| O'Nuallain, Brian, et al. "Amyloid β-protein dimers rapidly form stable synaptotoxic protofibrils." Journal of Neuroscience 30.43 (2010): 14411-14419. |
| Mikhalyov, I., et al. "Designed fluorescent probes reveal interactions between amyloid-β (1–40) peptides and GM1 gangliosides in micelles and lipid vesicles." Biophysical journal 99.5 (2010): 1510-1519. |
| Shankar, G. M., et al. "Soluble amyloid β-protein dimers isolated directly from Alzheimer disease patients potently impair synaptic plasticity and memory." Nat Med 14 (2008): 837-842. |