Beta - Amyloid Peptide (1 - 42) (mouse, rat)
| Name | Beta - Amyloid Peptide (1 - 42) (mouse, rat) |
| Category | Beta-Amyloidand Related Peptides |
| One Letter Code | DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA |
| Three Letter Code | {Asp}{Ala}{Glu}{Phe}{Gly}{His}{Asp}{Ser}{Gly}{Phe}{Glu}{Val}{Arg}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}{Gly}{Gly}{Val}{Val}{Ile}{Ala} |
| Molecular Weight | 4418.000 |
| Application | Alzheimer's DiseaseAntimicrobial & Antiviral Peptides |
| Sui, Yu-Ting, et al. "Alpha synuclein is transported into and out of the brain by the blood–brain barrier." Peptides 62 (2014): 197-202. |
| Díaz-Moreno, María, et al. "Aβ increases neural stem cell activity in senescence-accelerated SAMP8 mice." Neurobiology of aging 34.11 (2013): 2623-2638. |
| Erickson, Michelle A., et al. "Lipopolysaccharide impairs amyloid beta efflux from brain: altered vascular sequestration, cerebrospinal fluid reabsorption, peripheral clearance and transporter function at the blood–brain barrier." Journal of neuroinflammation 9.1 (2012): 150. |
| Erickson, Michelle A., Kim Hansen, and William A. Banks. "Inflammation-induced dysfunction of the low-density lipoprotein receptor-related protein-1 at the blood–brain barrier: protection by the antioxidant N-acetylcysteine." Brain, behavior, and immunity 26.7 (2012): 1085-1094. |
| Soscia, Stephanie J., et al. "The Alzheimer's disease-associated amyloid β-protein is an antimicrobial peptide." PloS one 5.3 (2010). |