Cys - beta - Amyloid (1 - 40)
| Name | Cys - beta - Amyloid (1 - 40) |
| Category | Beta-Amyloidand Related Peptides |
| One Letter Code | CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| Three Letter Code | {Cys}{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}{Gly}{Gly}{Val}{Val} |
| Molecular Weight | 4433.000 |
| Application | Alzheimer's Disease |
| Favit, Antonella, Maurizio Grimaldi, and Daniel L. Alkon. "Prevention of β‐Amyloid Neurotoxicity by Blockade of the Ubiquitin—Proteasome Proteolytic Pathway." Journal of neurochemistry 75.3 (2000): 1258-1263. |
| Kim, Bo-Hyun, et al. "Single-molecule atomic force microscopy force spectroscopy study of Aβ-40 interactions." Biochemistry 50.23 (2011): 5154-5162. |
| Majzik, A., et al. "Functionalization of gold nanoparticles with amino acid, β-amyloid peptides and fragment." Colloids and Surfaces B: Biointerfaces 81.1 (2010): 235-241. |