Adrenomedullin (13-52) (human)
| Name | Adrenomedullin (13-52) (human) |
| Category | Adrenomedullin Peptides |
| One Letter Code | SFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH₂ (Disulfide bridge: 4-9) |
| Three Letter Code | {Ser}{Phe}{Gly}{Cys}{Arg}{Phe}{Gly}{Thr}{Cys}{Thr}{Val}{Gln}{Lys}{Leu}{Ala}{His}{Gln}{Ile}{Tyr}{Gln}{Phe}{Thr}{Asp}{Lys}{Asp}{Lys}{Asp}{Asn}{Val}{Ala}{Pro}{Arg}{Ser}{Lys}{Ile}{Ser}{Pro}{Gln}{Gly}{Tyr}-NH₂ (Disulfide bridge: 4-9) (Disulfide bridge: 4-9) |
| Molecular Weight | 4533.130 |
| Application | Cardiovascular System & DiseasesInflammation Research |
| Chu, Duc Quyen, et al. "A comparative study of the ability of calcitonin gene‐related peptide and adrenomedullin13–52 to modulate microvascular but not thermal hyperalgesia responses." British journal of pharmacology 130.7 (2000): 1589-1596. |
| Hyman, Albert L., et al. "Novel catheterization technique for the in vivo measurement of pulmonary vascular responses in rats." American Journal of Physiology-Heart and Circulatory Physiology 274.4 (1998): H1218-H1229. |
| Sone, Masahiko, et al. "Specific adrenomedullin binding sites in the human brain." Peptides 18.8 (1997): 1125-1129. |
| Heaton, J. O. H. N., et al. "Pulmonary vasodilation to adrenomedullin: a novel peptide in humans." American Journal of Physiology-Heart and Circulatory Physiology 268.6 (1995): H2211-H2215. |