Beta - Amyloid (42 - 1)

Description:

Inactive control for the Aβ, reverse sequence of Aβ 1-42,.

Sequence:

AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD

General

References

Comments (0)

Name	Beta - Amyloid (42 - 1)
Category	Beta-Amyloidand Related Peptides
One Letter Code	AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Three Letter Code	{Ala}{Ile}{Val}{Val}{Gly}{Gly}{Val}{Met}{Leu}{Gly}{Ile}{Ile}{Ala}{Gly}{Lys}{Asn}{Ser}{Gly}{Val}{Asp}{Glu}{Ala}{Phe}{Phe}{Val}{Leu}{Lys}{Gln}{His}{His}{Val}{Glu}{Tyr}{Gly}{Ser}{Asp}{His}{Arg}{Phe}{Glu}{Ala}{Asp}
Molecular Weight	4514.100
Application	Alzheimer's Disease

van Gijsel-Bonnello, Manuel, et al. "Metabolic changes and inflammation in cultured astrocytes from the 5xFAD mouse model of Alzheimer’s disease: alleviation by pantethine." PloS one 12.4 (2017).

Griffin, Jarred M., et al. "Statins inhibit fibrillary β-amyloid induced inflammation in a model of the human blood brain barrier." PloS one 11.6 (2016).

Byun, J., et al. "CR6-interacting factor 1 is a key regulator in A β-induced mitochondrial disruption and pathogenesis of Alzheimer’s disease." Cell Death & Differentiation 22.6 (2015): 959-973.

Modi, Khushbu K., et al. "A physically-modified saline suppresses neuronal apoptosis, attenuates tau phosphorylation and protects memory in an animal model of Alzheimer's disease." PLoS One 9.8 (2014).

Mairet-Coello, Georges, et al. "The CAMKK2-AMPK kinase pathway mediates the synaptotoxic effects of Aβ oligomers through Tau phosphorylation." Neuron 78.1 (2013): 94-108.

Díaz-Moreno, María, et al. "Aβ increases neural stem cell activity in senescence-accelerated SAMP8 mice." Neurobiology of aging 34.11 (2013): 2623-2638.

Choi, Soo Jung, et al. "2, 4-Di-tert-butylphenol from sweet potato protects against oxidative stress in PC12 cells and in mice." Journal of medicinal food 16.11 (2013): 977-983.

Capurro, Valeria, et al. "Pharmacological characterization of memoquin, a multi-target compound for the treatment of Alzheimer's disease." PLoS One 8.2 (2013): e56870.