Beta - Amyloid (2 - 42)
| Name | Beta - Amyloid (2 - 42) |
| Category | Beta-Amyloidand Related Peptides |
| One Letter Code | AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA |
| Three Letter Code | {Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}{Gly}{Gly}{Val}{Val}{Ile}{Ala} |
| Molecular Weight | 4399.000 |
| Application | Alzheimer's Disease |
| Wiltfang, Jens, et al. "Elevation of β-amyloid peptide 2–42 in sporadic and familial Alzheimer's disease and its generation in PS1 knockout cells." Journal of Biological Chemistry 276.46 (2001): 42645-42657. |
| Condic, Mateja, et al. "N-truncation and pyroglutaminylation enhances the opsonizing capacity of Aβ-peptides and facilitates phagocytosis by macrophages and microglia." Brain, behavior, and immunity 41 (2014): 116-125. |
| Bibl, Mirko, et al. "Aminoterminally truncated and oxidized amyloid-β peptides in the cerebrospinal fluid of Alzheimer's disease patients." Journal of Alzheimer's Disease 29.4 (2012): 809-816. |
| Bibl, Mirko, et al. "Cerebrospinal fluid amyloid-β 2-42 is decreased in Alzheimer’s, but not in frontotemporal dementia." Journal of neural transmission 119.7 (2012): 805-813. |