SARS - CoV - 2 Spike RBD (receptor binding domain), 395 - 430 - Lys(Biotin - Ahx)
| Name | SARS - CoV - 2 Spike RBD (receptor binding domain), 395 - 430 - Lys(Biotin - Ahx) |
| Category | COVID-19 |
| One Letter Code | VYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFT-K(Biotin-Ahx)-NH2 |
| Three Letter Code | H - { Val }{ Tyr }{ Ala }{ Asp }{ Ser }{ Phe }{ Val }{ Ile }{ Arg }{ Gly }{ Asp }{ Glu }{ Val }{ Arg }{ Gln }{ Ile }{ Ala }{ Pro }{ Gly }{ Gln }{ Thr }{ Gly }{ Lys }{ Ile }{ Ala }{ Asp }{ Tyr }{ Asn }{ Tyr }{ Lys }{ Leu }{ Pro }{ Asp }{ Asp }{ Phe }{ Thr }{ Lys}(Biotin - Ahx) - NH2 |
| Molecular Weight | 4191.630 |
| Application | COVID-19 |
| 1. Wan Y, Shang J, et al. Receptor recognition by the novel coronavirus from Wuhan: an analysis based on decade-long structural studies of SARS coronavirus. J Virol. 2020 Mar 17;94(7). |
| 2. Chen Y, et al. Structure analysis of the receptor binding of 2019-nCoV. Biochem Biophys Res Commun. 2020 Feb 17. |