Stichodactyla helianthus Neurotoxin (ShK)

Description:

ShK-toxin inhibits the specific binding of dendrotoxin I to rat brain membranes. Due to its unique structure (it contains three intramolecular disulfide bridges) and high affinity for some potassium channels, ShK-toxin may become a useful molecular probe for investigating potassium channels.

Sequence:

RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bridge: 3 - 35, 12 - 28, 17 - 32)

General

References

Comments (0)

Name	Stichodactyla helianthus Neurotoxin (ShK)
Category	Toxins
One Letter Code	RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bridge: 3 - 35, 12 - 28, 17 - 32)
Three Letter Code	{Arg}{Ser}{Cys}{Ile}{Asp}{Thr}{Ile}{Pro}{Lys}{Ser}{Arg}{Cys}{Thr}{Ala}{Phe}{Gln}{Cys}{Lys}{His}{Ser}{Met}{Lys}{Tyr}{Arg}{Leu}{Ser}{Phe}{Cys}{Arg}{Lys}{Thr}{Cys}{Gly}{Thr}{Cys} (Disulfide bridge: 3-35, 12-28, 17-32) (Disulfide bridge: 3 - 35, 12 - 28, 17 - 32)
Molecular Weight	4054.830
Application	Ion Channel Modulating Agents

J.Andronic et al.,Biochim. Biophys. Acta,1828,699(2013)

P.Hajdu et al.,Biomaterials,34,10249(2013)

Z.Kuras et al.,Am. J. Physiol. Cell Physiol.,302,C1504(2012)

N.Bobak et al.,Biochim. Biophys. Acta,1808,2036(2011)