Amyloid β/A4 Protein Precursor (740-770)
| Name | Amyloid β/A4 Protein Precursor (740-770) |
| Category | Beta-Amyloidand Related Peptides |
| One Letter Code | AAVTPEERHLSKMQQNGYENPTYKFFEQMQN |
| Three Letter Code | {Ala}{Ala}{Val}{Thr}{Pro}{Glu}{Glu}{Arg}{His}{Leu}{Ser}{Lys}{Met}{Gln}{Gln}{Asn}{Gly}{Tyr}{Glu}{Asn}{Pro}{Thr}{Tyr}{Lys}{Phe}{Phe}{Glu}{Gln}{Met}{Gln}{Asn} |
| Molecular Weight | 3717.120 |
| Application | Alzheimer's Disease |
| Lu, Daniel C., et al. "Caspase cleavage of the amyloid precursor protein modulates amyloid β‐protein toxicity." Journal of neurochemistry 87.3 (2003): 733-741. |
| Chen, Yuzhi, et al. "APP-BP1 mediates APP-induced apoptosis and DNA synthesis and is increased in Alzheimer's disease brain." The Journal of cell biology 163.1 (2003): 27-33. |
| Galvan, Veronica, et al. "Caspase cleavage of members of the amyloid precursor family of proteins." Journal of neurochemistry 82.2 (2002): 283-294. |
| Dumanchin‐Njock, Cécile, et al. "The caspase‐derived C‐terminal fragment of βAPP induces caspase‐independent toxicity and triggers selective increase of Aβ42 in mammalian cells." Journal of neurochemistry 78.5 (2001): 1153-1161. |
| Lu, Daniel C., et al. "A second cytotoxic proteolytic peptide derived from amyloid β-protein precursor." Nature medicine 6.4 (2000): 397-404. |