Charybdotoxin

Description:

The 37-amino acid peptide charybdotoxin (ChTX) is a Ca2+-activated K+ channel blocker.

Sequence:

{pGLU}FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Disulfide bridge: 7-28, 13-33, 17-35)

General

References

Comments (0)

Name	Charybdotoxin
Category	Toxins
One Letter Code	{pGLU}FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Disulfide bridge: 7-28, 13-33, 17-35)
Three Letter Code	{pGLU}{Phe}{Thr}{Asn}{Val}{Ser}{Cys}{Thr}{Thr}{Ser}{Lys}{Glu}{Cys}{Trp}{Ser}{Val}{Cys}{Gln}{Arg}{Leu}{His}{Asn}{Thr}{Ser}{Arg}{Gly}{Lys}{Cys}{Met}{Asn}{Lys}{Lys}{Cys}{Arg}{Cys}{Tyr}{Ser} (Disulfide bridge: 7-28, 13-33, 17-35) (Disulfide bridge: 7-28, 13-33, 17-35)
Molecular Weight	4296.000
Application	Toxins

Leonard, Reid J., et al. "Selective blockers of voltage-gated K+ channels depolarize human T lymphocytes: mechanism of the antiproliferative effect of charybdotoxin." Proceedings of the National Academy of Sciences 89.21 (1992): 10094-10098.

Gimenez-Gallego, Guillermo, et al. "Purification, sequence, and model structure of charybdotoxin, a potent selective inhibitor of calcium-activated potassium channels." Proceedings of the National Academy of Sciences 85.10 (1988): 3329-3333.

Sugg, E. E., et al. "Synthesis and structural characterization of charybdotoxin, a potent peptidyl inhibitor of the high conductance Ca2 (+)-activated K+ channel." Journal of Biological Chemistry 265.31 (1990): 18745-18748.