Iberiotoxin (IbTX)

Description:

Iberiotoxin (IbTx) shows 68% sequence homology with charybdotoxin, another scorpion-derived peptidyl toxin. Iberiotoxin can be used to selectively study the function of the high conductance Ca²⁺ activated K⁺ channel.

Sequence:

{pGLU}FTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ (Disulfide bridge: 7 - 28,13 - 33, 17 - 35)

General

References

Comments (0)

Name	Iberiotoxin (IbTX)
Category	Toxins
One Letter Code	{pGLU}FTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ (Disulfide bridge: 7 - 28,13 - 33, 17 - 35)
Three Letter Code	{pGLU}Phe}{Thr}{Asp}{Val}{Asp}{Cys}{Ser}{Val}{Ser}{Lys}{Glu}{Cys}{Trp}{Ser}{Val}{Cys}{Lys}{Asp}{Leu}{Phe}{Gly}{Val}{Asp}{Arg}{Gly}{Lys}{Cys}{Met}{Gly}{Lys}{Lys}{Cys}{Arg}{Cys}{Tyr}{Gln} (Disulfide bridge: 7-28, 13-33, 17-35) (Disulfide bridge: 7 - 28,13 - 33, 17 - 35)
Molecular Weight	4230.900
Application	Toxins

Galvez, Antonio, et al. "Purification and characterization of a unique, potent, peptidyl probe for the high conductance calcium-activated potassium channel from venom of the scorpion Buthus tamulus." Journal of Biological Chemistry 265.19 (1990): 11083-11090.

Candia, Sebastian, Maria L. Garcia, and Ramon Latorre. "Mode of action of iberiotoxin, a potent blocker of the large conductance Ca (2+)-activated K+ channel." Biophysical journal 63.2 (1992): 583-590.