(Pyr³)-Amyloid β-Protein (3-42)

Description:

(Pyr³)-Amyloid β-Protein (3-42) was found to be the predominant amyloid β-peptide structure deposited in human brain of Alzheimer's disease and Down's syndrome patients.

Sequence:

{pGLU}FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

General

References

Comments (0)

Name	(Pyr³)-Amyloid β-Protein (3-42)
Category	Beta-Amyloidand Related Peptides
One Letter Code	{pGLU}FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Three Letter Code	{pGLU}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}{Gly}{Gly}{Val}{Val}{Ile}{Ala}
Molecular Weight	4309.920
Application	Alzheimer's Disease

Gillman, Alan L., et al. "Activity and architecture of pyroglutamate-modified Amyloid-β (AβpE3-42) pores." The journal of physical chemistry B 118.26 (2014): 7335-7344.

Lee, Joon, et al. "Role of the fast kinetics of pyroglutamate-modified amyloid-β oligomers in membrane binding and membrane permeability." Biochemistry 53.28 (2014): 4704-4714.

De Kimpe, Line, et al. "Intracellular accumulation of aggregated pyroglutamate amyloid beta: convergence of aging and Aβ pathology at the lysosome." Age 35.3 (2013): 673-687.

Hook, Gregory, et al. "Brain pyroglutamate amyloid-β is produced by cathepsin B and is reduced by the cysteine protease inhibitor E64d, representing a potential Alzheimer's disease therapeutic." Journal of Alzheimer's Disease 41.1 (2014): 129-149.

Perez-Garmendia, Roxanna, and Goar Gevorkian. "Pyroglutamate-modified amyloid beta peptides: emerging targets for Alzheimer s disease immunotherapy." Current neuropharmacology 11.5 (2013): 491-498.

Nussbaum, Justin M., et al. "Prion-like behaviour and tau-dependent cytotoxicity of pyroglutamylated amyloid-β." Nature 485.7400 (2012): 651-655.