(Pyr³)-Amyloid β-Protein (3-40)

Description:

The pyroglutamate-modified Aβ peptides is the potential key participants in the pathology of Alzheimer's disease (AD) due to their abundance in AD brain, high aggregation propensity, stability, and cellular toxicity.

Sequence:

{pGLU}FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

General

References

Comments (0)

Name	(Pyr³)-Amyloid β-Protein (3-40)
Category	Beta-Amyloidand Related Peptides
One Letter Code	{pGLU}FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Three Letter Code	{pGLU}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}{Gly}{Gly}{Val}{Val}
Molecular Weight	4125.680
Application	Alzheimer's Disease

Hook, Gregory, et al. "Brain pyroglutamate amyloid-β is produced by cathepsin B and is reduced by the cysteine protease inhibitor E64d, representing a potential Alzheimer's disease therapeutic." Journal of Alzheimer's Disease 41.1 (2014): 129-149.

Perez-Garmendia, Roxanna, and Goar Gevorkian. "Pyroglutamate-modified amyloid beta peptides: emerging targets for Alzheimer s disease immunotherapy." Current neuropharmacology 11.5 (2013): 491-498.

Schlenzig, Dagmar, et al. "N‐Terminal pyroglutamate formation of Aβ38 and Aβ40 enforces oligomer formation and potency to disrupt hippocampal long‐term potentiation." Journal of neurochemistry 121.5 (2012): 774-784.

Jawhar, Sadim, Oliver Wirths, and Thomas A. Bayer. "Pyroglutamate amyloid-β (Aβ): a hatchet man in Alzheimer disease." Journal of Biological Chemistry 286.45 (2011): 38825-38832.

Russo, Claudio, et al. "Pyroglutamate‐modified amyloid β‐peptides–AβN3 (pE)–strongly affect cultured neuron and astrocyte survival." Journal of neurochemistry 82.6 (2002): 1480-1489.