Apelin - 36 (human)
| Name | Apelin - 36 (human) |
| Category | Apelin Peptides |
| One Letter Code | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |
| Three Letter Code | {Leu}{Val}{Gln}{Pro}{Arg}{Gly}{Ser}{Arg}{Asn}{Gly}{Pro}{Gly}{Pro}{Trp}{Gln}{Gly}{Gly}{Arg}{Arg}{Lys}{Phe}{Arg}{Arg}{Gln}{Arg}{Pro}{Arg}{Leu}{Ser}{His}{Lys}{Gly}{Pro}{Met}{Pro}{Phe} |
| Molecular Weight | 4195.900 |
| Application | Infectious Disease, Virology, Cardiovascular System & Diseases |
| Cayabyab, Mark, et al. "Apelin, the natural ligand of the orphan seven-transmembrane receptor APJ, inhibits human immunodeficiency virus type 1 entry." Journal of virology 74.24 (2000): 11972-11976. |
| Goazigo, Annabelle Reaux-Le, et al. "Dehydration-induced cross-regulation of apelin and vasopressin immunoreactivity levels in magnocellular hypothalamic neurons." Endocrinology 145.9 (2004): 4392-4400. |
| Picault, François-Xavier, et al. "Tumour co-expression of apelin and its receptor is the basis of an autocrine loop involved in the growth of colon adenocarcinomas." European Journal of Cancer 50.3 (2014): 663-674. |