ACTH (1-39) (mouse, rat)
| Name | ACTH (1-39) (mouse, rat) |
| Category | ACTH and Related Peptides |
| One Letter Code | SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF |
| Three Letter Code | {Ser}{Tyr}{Ser}{Met}{Glu}{His}{Phe}{Arg}{Trp}{Gly}{Lys}{Pro}{Val}{Gly}{Lys}{Lys}{Arg}{Arg}{Pro}{Val}{Lys}{Val}{Tyr}{Pro}{Asn}{Val}{Ala}{Glu}{Asn}{Glu}{Ser}{Ala}{Glu}{Ala}{Phe}{Pro}{Leu}{Glu}{Phe} |
| Molecular Weight | 4582.230 |
| Application |
| Tennoune, Naouel, et al. "Sex-related effects of nutritional supplementation of Escherichia coli: Relevance to eating disorders." Nutrition 31.3 (2015): 498-507. |
| Steiner, Michel A., et al. "Examining the role of endogenous orexins in hypothalamus–pituitary–adrenal axis endocrine function using transient dual orexin receptor antagonism in the rat." Psychoneuroendocrinology 38.4 (2013): 560-571. |
| Tsukiyama, Naohiro, et al. "PACAP centrally mediates emotional stress-induced corticosterone responses in mice." Stress 14.4 (2011): 368-375. |
| Hentges, Shane T., et al. "Proopiomelanocortin expression in both GABA and glutamate neurons." Journal of Neuroscience 29.43 (2009): 13684-13690. |
| Galietta, Gabriella, et al. "Administration of antisense oligonucleotide against pro-opiomelanocortin prevents enduring hormonal alterations induced by neonatal handling in male mice." European journal of pharmacology 550.1-3 (2006): 180-185. |