ACTH (1 - 39) (human)
| Name | ACTH (1 - 39) (human) |
| Category | ACTH and Related Peptides |
| One Letter Code | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
| Three Letter Code | {Ser}{Tyr}{Ser}{Met}{Glu}{His}{Phe}{Arg}{Trp}{Gly}{Lys}{Pro}{Val}{Gly}{Lys}{Lys}{Arg}{Arg}{Pro}{Val}{Lys}{Val}{Tyr}{Pro}{Asn}{Gly}{Ala}{Glu}{Asp}{Glu}{Ser}{Ala}{Glu}{Ala}{Phe}{Pro}{Leu}{Glu}{Phe} |
| Molecular Weight | 4541.100 |
| Application |
| Lelle, Marco, et al. "Octreotide-mediated tumor-targeted drug delivery via a cleavable doxorubicin–peptide conjugate." Molecular pharmaceutics 12.12 (2015): 4290-4300. |
| Liu, Guei-Sheung, et al. "Proopiomelanocortin gene delivery induces apoptosis in melanoma through NADPH oxidase 4-mediated ROS generation." Free Radical Biology and Medicine 70 (2014): 14-22. |
| Tennoune, N., et al. "Bacterial ClpB heat-shock protein, an antigen-mimetic of the anorexigenic peptide α-MSH, at the origin of eating disorders." Translational psychiatry 4.10 (2014): e458-e458. |
| Sturgeon, Catharine M. "External quality assessment of hormone determinations." Best Practice & Research Clinical Endocrinology & Metabolism 27.6 (2013): 803-822. |
| Agulleiro, Maria Josep, et al. "Molecular characterization and functional regulation of melanocortin 2 receptor (MC2R) in the sea bass. A putative role in the adaptation to stress." PLoS One 8.5 (2013). |