LL-37 amide
| Name | LL-37 amide |
| Category | Antimicrobial and Related Peptides |
| One Letter Code | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH₂ |
| Three Letter Code | {Leu}{Leu}{Gly}{Asp}{Phe}{Phe}{Arg}{Lys}{Ser}{Lys}{Glu}{Lys}{Ile}{Gly}{Lys}{Glu}{Phe}{Lys}{Arg}{Ile}{Val}{Gln}{Arg}{Ile}{Lys}{Asp}{Phe}{Leu}{Arg}{Asn}{Leu}{Val}{Pro}{Arg}{Thr}{Glu}{Ser}-NH₂ |
| Molecular Weight | 4492.340 |
| Application | AngiogenesisAntimicrobial & Antiviral Peptides |
| Svensson, Daniel, et al. "Apolipoprotein AI attenuates LL-37-induced endothelial cell cytotoxicity." Biochemical and biophysical research communications 493.1 (2017): 71-76. |
| Svensson, Daniel, et al. "Human endogenous peptide p33 inhibits detrimental effects of LL‐37 on osteoblast viability." Journal of periodontal research 50.1 (2015): 80-88. |
| Choi, Heejun, et al. "Medium effects on minimum inhibitory concentrations of nylon-3 polymers against E. coli." PloS one 9.8 (2014). |
| Dosler, Sibel, and Elif Karaaslan. "Inhibition and destruction of Pseudomonas aeruginosa biofilms by antibiotics and antimicrobial peptides." Peptides 62 (2014): 32-37. |
| Hillaire, Marine LB, et al. "Front & Back Matter." Journal of Innate Immunity 5.3 (2013). |
| Vandamme, Dieter, et al. "A comprehensive summary of LL-37, the factotum human cathelicidin peptide." Cellular immunology 280.1 (2012): 22-35. |