LL - 37, Antimicrobial Peptide (human)
| Name | LL - 37, Antimicrobial Peptide (human) |
| Category | Antimicrobial and Related Peptides |
| One Letter Code | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Three Letter Code | {Leu}{Leu}{Gly}{Asp}{Phe}{Phe}{Arg}{Lys}{Ser}{Lys}{Glu}{Lys}{Ile}{Gly}{Lys}{Glu}{Phe}{Lys}{Arg}{Ile}{Val}{Gln}{Arg}{Ile}{Lys}{Asp}{Phe}{Leu}{Arg}{Asn}{Leu}{Val}{Pro}{Arg}{Thr}{Glu}{Ser} |
| Molecular Weight | 4493.300 |
| Application | AngiogenesisAntimicrobial & Antiviral PeptidesCancer ResearchInflammation Research |
| Dürr, Ulrich HN, U. S. Sudheendra, and Ayyalusamy Ramamoorthy. "LL-37, the only human member of the cathelicidin family of antimicrobial peptides." Biochimica et Biophysica Acta (BBA)-Biomembranes 1758.9 (2006): 1408-1425. |
| Neville, Frances, et al. "Lipid headgroup discrimination by antimicrobial peptide LL-37: insight into mechanism of action." Biophysical journal 90.4 (2006): 1275-1287. |
| Bonucci, Alessio, et al. "A spectroscopic study of the aggregation state of the human antimicrobial peptide LL-37 in bacterial versus host cell model membranes." Biochemistry 54.45 (2015): 6760-6768. |
| Bucki, Robert, et al. "Combined antibacterial and anti-inflammatory activity of a cationic disubstituted dexamethasone-spermine conjugate." Antimicrobial agents and chemotherapy 54.6 (2010): 2525-2533. |
| Leszczyńska, Katarzyna, et al. "Bactericidal activities of the cationic steroid CSA-13 and the cathelicidin peptide LL-37 against Helicobacter pylori in simulated gastric juice." BMC microbiology 9.1 (2009): 187. |
| Vandamme, Dieter, et al. "A comprehensive summary of LL-37, the factotum human cathelicidin peptide." Cellular immunology 280.1 (2012): 22-35. |