LL - 37, Antimicrobial Peptide (human)

Description:

LL-37 is an antimicrobial peptide with angiogenic activity.

Sequence:

[LL-37, 37 aa]
  • General
  • References
  • Comments (0)
  • Name LL - 37, Antimicrobial Peptide (human)
    Category Antimicrobial and Related Peptides
    One Letter Code [LL-37, 37 aa]
    Three Letter Code {Leu}{Leu}{Gly}{Asp}{Phe}{Phe}{Arg}{Lys}{Ser}{Lys}{Glu}{Lys}{Ile}{Gly}{Lys}{Glu}{Phe}{Lys}{Arg}{Ile}{Val}{Gln}{Arg}{Ile}{Lys}{Asp}{Phe}{Leu}{Arg}{Asn}{Leu}{Val}{Pro}{Arg}{Thr}{Glu}{Ser}
    Molecular Weight 4493.300
    Application AngiogenesisAntimicrobial & Antiviral PeptidesCancer ResearchInflammation Research
    Dürr, Ulrich HN, U. S. Sudheendra, and Ayyalusamy Ramamoorthy. "LL-37, the only human member of the cathelicidin family of antimicrobial peptides." Biochimica et Biophysica Acta (BBA)-Biomembranes 1758.9 (2006): 1408-1425.
    Neville, Frances, et al. "Lipid headgroup discrimination by antimicrobial peptide LL-37: insight into mechanism of action." Biophysical journal 90.4 (2006): 1275-1287.
    Bonucci, Alessio, et al. "A spectroscopic study of the aggregation state of the human antimicrobial peptide LL-37 in bacterial versus host cell model membranes." Biochemistry 54.45 (2015): 6760-6768.
    Bucki, Robert, et al. "Combined antibacterial and anti-inflammatory activity of a cationic disubstituted dexamethasone-spermine conjugate." Antimicrobial agents and chemotherapy 54.6 (2010): 2525-2533.
    Leszczyńska, Katarzyna, et al. "Bactericidal activities of the cationic steroid CSA-13 and the cathelicidin peptide LL-37 against Helicobacter pylori in simulated gastric juice." BMC microbiology 9.1 (2009): 187.
    Vandamme, Dieter, et al. "A comprehensive summary of LL-37, the factotum human cathelicidin peptide." Cellular immunology 280.1 (2012): 22-35.
    #[first_name]
    #[create_date]
    #[comment]
    Reply(#[reply_num])
    #[like_num]
  • #[first_name]
    #[create_date]
    #[comment]
    Reply
    #[like_num]