Cecropin B
| Name | Cecropin B |
| Category | Antimicrobial and Related Peptides |
| One Letter Code | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2 |
| Three Letter Code | {Lys}{Trp}{Lys}{Val}{Phe}{Lys}{Lys}{Ile}{Glu}{Lys}{Met}{Gly}{Arg}{Asn}{Ile}{Arg}{Asn}{Gly}{Ile}{Val}{Lys}{Ala}{Gly}{Pro}{Ala}{Ile}{Ala}{Val}{Leu}{Gly}{Glu}{Ala}{Lys}{Ala}{Leu}-NH2 |
| Molecular Weight | 3834.700 |
| Application |
| Vaara, Martti, and Timo Vaara. "Ability of cecropin B to penetrate the enterobacterial outer membrane." Antimicrobial agents and chemotherapy 38.10 (1994): 2498-2501. |
| Florack, Dion, et al. "Expression of giant silkmoth cecropin B genes in tobacco." Transgenic research 4.2 (1995): 132-141. |
| Lee, Phillip HA, et al. "HB‐107, a nonbacteriostatic fragment of the antimicrobial peptide cecropin B, accelerates murine wound repair." Wound repair and regeneration 12.3 (2004): 351-358. |